Drivers Category |
|
|
Drivers Update |
|
|
|
Drivers |
Jamaican font
Version: 6.40.90
Date: 23 April 2016
Filesize: 256 MB
Operating system: Windows XP, Visa, Windows 7,8,10 (32 & 64 bits)
Download Now
|
|
Home / Category / caribbean fonts Filter Options Only show commercial-use fonts Allow mature content (18+) fonts. General Serif · Sans- Serif · Italic · Letterbats · Initials · Small Caps Size Poster · Display · Headlines · Text · Small Text · Captions Weight Hairline · Thin · Light · Regular · Medium · Bold · Heavy · Black · Fat Width Monospaced · Ultra Narrow · Extra Narrow · Narrow · Wide · Extra Wide · Ultra Wide Occasion Weddings · Baby Showers · Birthdays · Parties · Tattoos Holidays Christmas · Hanukkah · Valentine's Day · St. Patrick's Day · Easter · Halloween · Decade1990's · 1980's · 1970's · 1960's · 1950's · 1940's · 1930's · 1920's · 1910's · 1900's · 1890's · Foreign Imitation African · Alien · Arabic · Asian · Greek · Mexican · Runic · Russian · Yesteryear Retro · Vintage · Typewriter · Art Deco · Antique · Art Nouveau · Medieval · Blackletter · Old English Modern Techno · Futuristic · Science- Fiction · Digital · LCD · Blocky · Geometric · Stenciled · Neon · Hard to Read Style3d · Chunky · Comic · Calligraphy · Cute · Decorative · Fancy · Distorted · Grungy · Eroded · Outlined · Contoured · Multi-linear · Filled · Pixel · Warped Mood Quirky · Girly · Scary · Romantic · Groovy · Funky · Hot · Cold Handwriting Cursive · Script · Feminine · Masculine · Formal · Informal · Messy · Neat · Scribbled · Brushed · Graffiti · Theme Famous · Brandname · Army · Wild West · Circus · TV · Movies · Music · Athletics · Varsity · Sports Dingbats Icons · Borders · Frames · Animals · People · Flowers · Hearts · Food · Special Free Fonts for Commercial Use · New & Fresh Fonts · Most Popular Fonts · Alphabetic Fonts · Largest Font Families · Trending Fonts Hello, you seem to have Java Script turned off. Please enable it to use the advanced features of this website. Fonts 1 - 10 of 183ancientxtextheadlinesregularmedievalcalligraphydisplayserifmediumblackletterboldvintagenarrowerodedsmall capsdrop capsflaredhandwrittengothiclightbracket serifdecorativeold englishold germanshadoweditalicglyphicgrungeforeign. Jamaica Funk 1 View profile Send a private message1 font - 22,437 downloads (1 yesterday) Preview Fonts Size Sort by Only as Public domain / GPL / OFL 100% Free Free for personal use Donationware Shareware Demo Unknown Only fonts with Accents Euro Jamaicafont by Jamaica Funk 22,437 downloads (1 yesterday) Free for personal use Jamaica Funk 1.
|
|